Structure of PDB 3res Chain B

Receptor sequence

>3resB (length=60) Species: 511693 (Escherichia coli BL21)

SLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVY
KHAISTVVPS

3D structure

• PDB: 3res Cooperation of Escherichia coli Hfq hexamers in DsrA binding.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	B	Y25 G29 T61	Y20 G24 T56

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:3res, PDBe:3res, PDBj:3res
• PDBsum: 3res
• PubMed: 21979921
• UniProt: P0A6X3|HFQ_ECOLI RNA-binding protein Hfq (Gene Name=hfq)