Structure of PDB 3rb4 Chain B

Receptor sequence

>3rb4B (length=341) Species: 273057 (Saccharolobus solfataricus P2)

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 3rb4 Implications for damage recognition during Dpo4-mediated mutagenic bypass of m1G and m3C lesions.
• Chain: B
• Resolution: 2.805 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S1103 E1106 G1185 G1187 I1189 T1190 K1221 I1295 V1296 R1298	S103 E106 G185 G187 I189 T190 K221 I295 V296 R298
BS02	dna	B	F1033 S1034 S1040 G1041 E1219 A1220 R1242 K1243 G1246 R1247 I1248 T1250 R1331 R1332 R1336	F33 S34 S40 G41 E219 A220 R242 K243 G246 R247 I248 T250 R331 R332 R336
BS03	DGT	B	Y1010 Y1012 A1044 T1045 Y1048 R1051 D1105 K1159	Y10 Y12 A44 T45 Y48 R51 D105 K159
BS04	CA	B	D1007 D1105 E1106	D7 D105 E106
BS05	CA	B	D1007 F1008 D1105	D7 F8 D105
BS06	CA	B	A1181 I1186	A181 I186

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3rb4, PDBe:3rb4, PDBj:3rb4
• PDBsum: 3rb4
• PubMed: 21645853
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)