Structure of PDB 3rb0 Chain B

Receptor sequence

>3rb0B (length=341) Species: 273057 (Saccharolobus solfataricus P2)

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 3rb0 Implications for damage recognition during Dpo4-mediated mutagenic bypass of m1G and m3C lesions.
• Chain: B
• Resolution: 3.225 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	P1184 G1185 G1187 N1188 I1189 T1190 D1294 V1296 R1298	P184 G185 G187 N188 I189 T190 D294 V296 R298
BS02	dna	B	V1032 S1034 G1041 G1218 A1220 R1242 K1243 S1244 I1245 G1246 R1247 I1248 L1293 R1331 R1332 R1336	V32 S34 G41 G218 A220 R242 K243 S244 I245 G246 R247 I248 L293 R331 R332 R336
BS03	DGT	B	Y1010 Y1012 A1044 T1045 R1051	Y10 Y12 A44 T45 R51
BS04	CA	B	D1007 D1105 E1106	D7 D105 E106
BS05	CA	B	D1007 F1008 D1105	D7 F8 D105
BS06	CA	B	V1183 I1186	V183 I186

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3rb0, PDBe:3rb0, PDBj:3rb0
• PDBsum: 3rb0
• PubMed: 21645853
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)