Structure of PDB 3raq Chain B

Receptor sequence

>3raqB (length=341) Species: 2287 (Saccharolobus solfataricus)

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 3raq Implications for damage recognition during Dpo4-mediated mutagenic bypass of m1G and m3C lesions.
• Chain: B
• Resolution: 2.25 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	P1184 G1185 I1186 G1187 I1189 T1190 V1296 S1297 R1298 G1299 T1301	P184 G185 I186 G187 I189 T190 V296 S297 R298 G299 T301
BS02	dna	B	V1032 F1037 S1040 G1041 A1042 P1060 A1220 R1242 K1243 S1244 G1246 R1247 I1248 V1249 T1250 L1293 R1331 R1332	V32 F37 S40 G41 A42 P60 A220 R242 K243 S244 G246 R247 I248 V249 T250 L293 R331 R332
BS03	DGT	B	Y1010 F1011 Y1012 A1044 Y1048 R1051 D1105	Y10 F11 Y12 A44 Y48 R51 D105
BS04	CA	B	D1007 D1105 E1106	D7 D105 E106
BS05	CA	B	D1007 F1008 D1105	D7 F8 D105
BS06	CA	B	A1181 I1186	A181 I186

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3raq, PDBe:3raq, PDBj:3raq
• PDBsum: 3raq
• PubMed: 21645853
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)