Structure of PDB 3r2d Chain B

Receptor sequence

>3r2dB (length=138) Species: 63363 (Aquifex aeolicus)

MMRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKK
LVDTAVRHIEEIDSIIEKHLKGWSIDRLGYVERNALRLGVAELIFLKSKE
PGRVFIDIVDLVKKYADEKAGKFVNGVLSAIYKAYITS

3D structure

• PDB: 3r2d Structural basis for RNA recognition by NusB and NusE in the initiation of transcription antitermination.
• Chain: B
• Resolution: 2.199 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	K36 K39 N40 K113	K37 K40 N41 K114

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006353 DNA-templated transcription termination
• GO:0006355 regulation of DNA-templated transcription
• GO:0031564 transcription antitermination

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3r2d, PDBe:3r2d, PDBj:3r2d
• PDBsum: 3r2d
• PubMed: 21652641
• UniProt: O66530|NUSB_AQUAE Transcription antitermination protein NusB (Gene Name=nusB)