Structure of PDB 3r0w Chain B |
>3r0wB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGI GGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF |
|
PDB | 3r0w Crystal structures of multidrug-resistant HIV-1 protease in complex with two potent anti-malarial compounds. |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
N25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
N25 T26 G27 |
Enzyme Commision number |
3.1.26.13: retroviral ribonuclease H. |
|
|
|
|