Structure of PDB 3qsy Chain B |
>3qsyB (length=89) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] |
KVKMSGLITVRTNEPLGVEKIKEVISKALENIEQDYESLLNIKIYTIGAP RYRVDVVGTNPKEASEALNQIISNLIKIGKEENVDISVV |
|
PDB | 3qsy Crystal structure of the archaeal translation initiation factor 2 in complex with a GTP analogue and Met-tRNAf(Met.) |
Chain | B |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B |
A224 R226 |
A49 R51 |
|
|
|
|