Structure of PDB 3qsu Chain B

Receptor sequence

>3qsuB (length=61) Species: 889933 (Staphylococcus aureus subsp. aureus ECT-R 2)

NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLI
YKHAISTYTVE

3D structure

• PDB: 3qsu Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.
• Chain: B
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	N28 F30	N23 F25	PDBbind-CN: Kd=19.5nM
BS02	ZN	B	K51 H53	K46 H48

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 22 15:11:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3qsu', asym_id = 'B', title = 'Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3qsu', asym_id='B', title='Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0006355', uniprot = '', pdbid = '3qsu', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0006355', uniprot='', pdbid='3qsu', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>