Structure of PDB 3qqr Chain B

Receptor sequence
>3qqrB (length=148) Species: 3476 (Parasponia andersonii) [Search protein sequence]
VFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKSVL
EQNPKLKPHATTVFVMTCESAVQLRKAGKVTVKESDLKRIGAIHFKTGVV
NEHFEVTRFALLETIKEAVPEMWSPEMKNAWGVAYDQLVAAIKFEMKP
3D structure
PDB3qqr Crystal structures of Parasponia and Trema hemoglobins: differential heme coordination is linked to quaternary structure.
ChainB
Resolution2.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.7.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B L50 F51 Y53 H70 R100 I101 I104 H105 T108 V110 H114 F115 T118 Y146 L149 I153 L42 F43 Y45 H59 R89 I90 I93 H94 T97 V99 H103 F104 T107 Y135 L138 I142
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009399 nitrogen fixation
GO:0015671 oxygen transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qqr, PDBe:3qqr, PDBj:3qqr
PDBsum3qqr
PubMed21491905
UniProtP68168|HBPL_PARAD Anaerobic nitrite reductase (Gene Name=HB)

[Back to BioLiP]