Structure of PDB 3qgp Chain B

Receptor sequence

>3qgpB (length=110) Species: 158879 (Staphylococcus aureus subsp. aureus N315)

AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDT
DEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVF
KYDIGYHYQK

3D structure

• PDB: 3qgp Heme Ruffling Enables the Catalytic Activity of the Heme Degrading Enzyme IsdI
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 1.14.99.48: heme oxygenase (staphylobilin-producing).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	N6 R21 F22 R25 Q26 I28 I53 W66 H76 V79 N95	N8 R23 F24 R27 Q28 I30 I55 W68 H78 V81 N97

Gene Ontology

Molecular Function

• GO:0004392 heme oxygenase (decyclizing) activity
• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0033212 iron import into cell
• GO:0042167 heme catabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3qgp, PDBe:3qgp, PDBj:3qgp
• PDBsum: 3qgp
• UniProt: Q7A827|HDOX2_STAAN Heme oxygenase (staphylobilin-producing) 2 (Gene Name=isdI)