Structure of PDB 3q5f Chain B

Receptor sequence
>3q5fB (length=140) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search protein sequence]
SPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQL
AKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKAEPLIAE
MEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHS
3D structure
PDB3q5f Crystal Structures of SlyA Protein, a Master Virulence Regulator of Salmonella, in Free and DNA-bound States.
ChainB
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B S48 Q49 I50 Q60 P61 V64 R78 R86 A87 K88 S46 Q47 I48 Q58 P59 V62 R76 R84 A85 K86
BS02 dna B T30 T32 I58 E59 P61 S62 R65 R85 R86 T28 T30 I56 E57 P59 S60 R63 R83 R84
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3q5f, PDBe:3q5f, PDBj:3q5f
PDBsum3q5f
PubMed21550983
UniProtP40676|SLYA_SALTY Transcriptional regulator SlyA (Gene Name=slyA)

[Back to BioLiP]