Structure of PDB 3pvp Chain B

Receptor sequence
>3pvpB (length=95) Species: 419947 (Mycobacterium tuberculosis H37Ra) [Search protein sequence]
ISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSLP
KIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRS
3D structure
PDB3pvp Structural and Thermodynamic Signatures of DNA Recognition by Mycobacterium tuberculosis DnaA.
ChainB
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K436 R444 Q445 R468 D469 T471 T472 Y475 K479 K26 R34 Q35 R58 D59 T61 T62 Y65 K69 PDBbind-CN: Kd=60nM
BS02 dna B K436 R438 S458 L459 P460 H470 M474 K26 R28 S48 L49 P50 H60 M64 PDBbind-CN: Kd=60nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003688 DNA replication origin binding
GO:0005524 ATP binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006270 DNA replication initiation
GO:0006275 regulation of DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3pvp, PDBe:3pvp, PDBj:3pvp
PDBsum3pvp
PubMed21620858
UniProtA5TY69|DNAA_MYCTA Chromosomal replication initiator protein DnaA (Gene Name=dnaA)

[Back to BioLiP]