Structure of PDB 3pcr Chain B

Receptor sequence
>3pcrB (length=160) Species: 9606 (Homo sapiens) [Search protein sequence]
MRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWD
VGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMR
DAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLY
EGLTWLTSNY
3D structure
PDB3pcr The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold.
ChainB
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q67
Catalytic site (residue number reindexed from 1) Q54
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP B D22 A23 G25 K26 T27 T28 T41 T44 G65 N122 K123 L126 C155 A156 D9 A10 G12 K13 T14 T15 T28 T31 G52 N109 K110 L113 C142 A143
BS02 MG B T27 T44 T14 T31
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0031996 thioesterase binding
GO:0035591 signaling adaptor activity
Biological Process
GO:0001889 liver development
GO:0006886 intracellular protein transport
GO:0007155 cell adhesion
GO:0007399 nervous system development
GO:0010975 regulation of neuron projection development
GO:0010976 positive regulation of neuron projection development
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0030154 cell differentiation
GO:0030838 positive regulation of actin filament polymerization
GO:0030866 cortical actin cytoskeleton organization
GO:0032456 endocytic recycling
GO:0034394 protein localization to cell surface
GO:0035020 regulation of Rac protein signal transduction
GO:0036010 protein localization to endosome
GO:0048261 negative regulation of receptor-mediated endocytosis
GO:0048488 synaptic vesicle endocytosis
GO:0050714 positive regulation of protein secretion
GO:0051301 cell division
GO:0051489 regulation of filopodium assembly
GO:0051549 positive regulation of keratinocyte migration
GO:0060998 regulation of dendritic spine development
GO:0072659 protein localization to plasma membrane
GO:0090162 establishment of epithelial cell polarity
GO:0097178 ruffle assembly
GO:0097284 hepatocyte apoptotic process
GO:0099562 maintenance of postsynaptic density structure
GO:0120183 positive regulation of focal adhesion disassembly
GO:1902217 erythrocyte apoptotic process
GO:1903078 positive regulation of protein localization to plasma membrane
GO:1903438 positive regulation of mitotic cytokinetic process
GO:1905345 protein localization to cleavage furrow
GO:1905606 regulation of presynapse assembly
GO:1990090 cellular response to nerve growth factor stimulus
GO:2000009 negative regulation of protein localization to cell surface
GO:2000171 negative regulation of dendrite development
Cellular Component
GO:0001726 ruffle
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0005938 cell cortex
GO:0016020 membrane
GO:0030139 endocytic vesicle
GO:0030496 midbody
GO:0031527 filopodium membrane
GO:0031901 early endosome membrane
GO:0032154 cleavage furrow
GO:0042995 cell projection
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0090543 Flemming body
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3pcr, PDBe:3pcr, PDBj:3pcr
PDBsum3pcr
PubMed21170023
UniProtP62330|ARF6_HUMAN ADP-ribosylation factor 6 (Gene Name=ARF6)

[Back to BioLiP]