Structure of PDB 3p4q Chain B

Receptor sequence

>3p4qB (length=243) Species: 362663 (Escherichia coli 536)

AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPD
LSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIER
DLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCIN
CGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNG
VWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR

3D structure

• PDB: 3p4q Geometric restraint drives on- and off-pathway catalysis by the Escherichia coli menaquinol:fumarate reductase.
• Chain: B
• Resolution: 3.35 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	B	S56 C57 R58 A60 C62 G63 S64 C65 L75 C77	S56 C57 R58 A60 C62 G63 S64 C65 L75 C77
BS02	F3S	B	C158 P159 C204 F206 V207 G208 C210 I224	C158 P159 C204 F206 V207 G208 C210 I224
BS03	SF4	B	C148 I149 N150 C151 G152 C154 A171 C214 P215	C148 I149 N150 C151 G152 C154 A171 C214 P215

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008177 succinate dehydrogenase (quinone) activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0006113 fermentation
• GO:0009061 anaerobic respiration
• GO:0019645 anaerobic electron transport chain
• GO:0044780 bacterial-type flagellum assembly

Cellular Component

• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045283 fumarate reductase complex

External links

• PDB: RCSB:3p4q, PDBe:3p4q, PDBj:3p4q
• PDBsum: 3p4q
• PubMed: 21098488
• UniProt: P0AC47|FRDB_ECOLI Fumarate reductase iron-sulfur subunit (Gene Name=frdB)