Structure of PDB 3p3u Chain B |
>3p3uB (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA LLSPYSYSTTAVVTN |
|
PDB | 3p3u Potent kinetic stabilizers that prevent transthyretin-mediated cardiomyocyte proteotoxicity. |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3M4 |
B |
A108 L110 S117 |
A99 L101 S108 |
PDBbind-CN: -logKd/Ki=6.48,IC50=0.3291uM BindingDB: IC50=329nM |
|
|
|