Structure of PDB 3p3t Chain B |
>3p3tB (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] |
PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL LSPYSYSTTAVVTN |
|
PDB | 3p3t Potent kinetic stabilizers that prevent transthyretin-mediated cardiomyocyte proteotoxicity. |
Chain | B |
Resolution | 1.45 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3M3 |
B |
K15 A108 L110 S117 |
K5 A98 L100 S107 |
PDBbind-CN: -logKd/Ki=7.24,Kd=57.91nM BindingDB: IC50=296nM,Kd=320nM |
|
|
|