Structure of PDB 3p3r Chain B |
>3p3rB (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA LLSPYSYSTTAVVTN |
|
PDB | 3p3r Potent kinetic stabilizers that prevent transthyretin-mediated cardiomyocyte proteotoxicity. |
Chain | B |
Resolution | 1.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
3M1 |
B |
K15 L17 A108 L110 |
K6 L8 A99 L101 |
PDBbind-CN: -logKd/Ki=7.25,Kd=56.05nM BindingDB: IC50=755nM,Kd=184nM |
|
|
|