Structure of PDB 3or1 Chain B

Receptor sequence

>3or1B (length=385) Species: 879 (Megalodesulfovibrio gigas)

AFISSGYNPAKPMENRITDIGPRKFTEFFPPVIAKNAGNWDYHEILEPGI
LVHVAKNGDKVFTVRCGAARLMSTSHIREACEIAKKFCNGHLRFTTRNNI
EFMVDNEETLKALVADLKTRKFAAGSFKFPIGGTGASISNIVHTQGWVYC
HTPATDASGPVKAVMDELFEEFTSMRLPAIVRVSLACCINMCGAVHCSDI
GLVGIHRKPPMIDHENLAELCEIPLAVAACPTAAVKPITAEVNGQKVKSV
AINNDRCMYCGNCYTMCPALPLSDGTGDGIAIMVGGKISNRIKVPSFSKV
VVAFVPNEPPRWPTMAKIVKKIVEVYAEDARKYERIGDWIHRIGWETFYE
KTGLEFSHHCIDDFRDPAYYTWRQSTQFKFVSFDS

3D structure

• PDB: 3or1 Structure insights into the enzyme catalysis from comparison of three forms of dissimilatory sulfite reductase from Desulfovibrio gigas
• Chain: B
• Resolution: 1.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SRM	B	R71 T145 Q146 Y150 C151 H152 N191 C193 G194	R70 T144 Q145 Y149 C150 H151 N190 C192 G193
BS02	SRM	B	H44 R66 R94 T96 T97 R98 N100 E102 T135 G136 S140 R183 K288 I289 S290 R292 R336	H43 R65 R93 T95 T96 R97 N99 E101 T134 G135 S139 R182 K287 I288 S289 R291 R335
BS03	SF4	B	T145 C151 T153 P154 C188 C189 N191 C193	T144 C150 T152 P153 C187 C188 N190 C192
BS04	SF4	B	C231 A235 V236 I253 C258 M259 Y260 C261 G262 C264	C230 A234 V235 I252 C257 M258 Y259 C260 G261 C263

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016002 sulfite reductase activity
• GO:0016491 oxidoreductase activity
• GO:0018551 dissimilatory sulfite reductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0050311 sulfite reductase (ferredoxin) activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0000103 sulfate assimilation
• GO:0006790 sulfur compound metabolic process

Cellular Component

• GO:0009337 sulfite reductase complex (NADPH)

External links

• PDB: RCSB:3or1, PDBe:3or1, PDBj:3or1
• PDBsum: 3or1
• UniProt: E2QR96