Structure of PDB 3oo1 Chain B |
>3oo1B (length=128) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY GFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQA GASGYVVKPFTPATLEEKLNKIFEKLGM |
|
PDB | 3oo1 Exploring the effect of an allosteric site on conformational coupling in CheY |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D12 D13 D57 N59 |
D11 D12 D56 N58 |
|
|
|
|