Structure of PDB 3ojl Chain B

Receptor sequence

>3ojlB (length=412) Species: 1280 (Staphylococcus aureus)

SKLTVVGLGYIGLPTSIMFAKHGVDVLGVDINQQTIDKLQNGQISIEEPG
LQEVYEEVLSSGKLKVSTTPEASDVFIIAVPTPNNDDQYRSCDISLVMRA
LDSILPFLKKGNTIIVESTIAPKTMDDFVKPVIENLGFTIGEDIYLVHCP
ERVLPGKILEELVHNNRIIGGVTKACIEAGKRVYRTFVQGEMIETDARTA
EMSKLMENTYRDVNIALANELTKICNNLNINVLDVIEMANKHPRVNIHQP
GPGVGGHCLAVDPYFNAKLIQTGREINNSMPAYVVDTTKQIIKALSGNKV
TVFGLTYKGDVDDIRESPAFDIYELLNQEPDIEVCAYDPHVELDFVEHDM
SHAVKDASLVLILSDHSEFKNLSDSHFDKMKHKVIFDTKNVVKSSFEDVL
YYNYGNIFNFID

3D structure

• PDB: 3ojl Structure Analysis of the Staphylococcus aureus UDP-N-acetyl-mannosamine Dehydrogenase Cap5O Involved in Capsular Polysaccharide Biosynthesis.
• Chain: B
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T119 P155 K204 N208 C258 D262
• Catalytic site (residue number reindexed from 1): T119 P155 K204 N208 C258 D262

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	B	V6 G7 G9 Y10 I11 D30 V80 P81 T82 T119 E151 V153 R322	V6 G7 G9 Y10 I11 D30 V80 P81 T82 T119 E151 V153 R315

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
• GO:0051287 NAD binding

Biological Process

• GO:0000271 polysaccharide biosynthetic process

External links

• PDB: RCSB:3ojl, PDBe:3ojl, PDBj:3ojl
• PDBsum: 3ojl
• PubMed: 21454499
• UniProt: P95708