Structure of PDB 3odv Chain B

Receptor sequence
>3odvB (length=38) Species: 6860 (Androctonus mauritanicus mauritanicus) [Search protein sequence]
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK
3D structure
PDB3odv Total chemical synthesis and X-ray structure of kaliotoxin by racemic protein crystallography.
ChainB
Resolution0.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 TFA B G1 K27 G1 K27
Gene Ontology
Molecular Function
GO:0008200 ion channel inhibitor activity
GO:0015459 potassium channel regulator activity
GO:0090729 toxin activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3odv, PDBe:3odv, PDBj:3odv
PDBsum3odv
PubMed20877851
UniProtP24662|KAX31_ANDMA Potassium channel toxin alpha-KTx 3.1

[Back to BioLiP]