Structure of PDB 3oa2 Chain B

Receptor sequence

>3oa2B (length=311) Species: 287 (Pseudomonas aeruginosa)

MKNFALIGAAGYIAPRHMRAIKDTGNCLVSAYDINDSVGIIDSISPQSEF
FTEFEFFLDHASNLKRDSATALDYVSICSPNYLHYPHIAAGLRLGCDVIC
EKPLVPTPEMLDQLAVIERETDKRLYNILQLRHHQAIIALKDKVAREKSP
HKYEVDLTYITSRGNWYLKSWKGDPRKSFGVATNIGVHFYDMLHFIFGKL
QRNVVHFTSEYKTAGYLEYEQARVRWFLSVDANDLPESVKGKKPTYRSIT
VNGEEMEFDLHTTSYEEILAGRGYGIDDARHCVETVNTIRSAVIVPASDN
EGHPFVAALAR

3D structure

• PDB: 3oa2 Structural and Functional Studies of WlbA: A Dehydrogenase Involved in the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid .
• Chain: B
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.335: UDP-N-acetyl-2-amino-2-deoxyglucuronate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	B	G11 Y12 I13 Y32 D33 I34 C78 S79 P80 N81 L83 H84 H87 E101 K102 Q130 W171 K172	G11 Y12 I13 Y32 D33 I34 C78 S79 P80 N81 L83 H84 H87 E101 K102 Q130 W171 K172

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003954 NADH dehydrogenase activity
• GO:0004617 phosphoglycerate dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0070403 NAD+ binding
• GO:0070404 NADH binding

Biological Process

• GO:0000271 polysaccharide biosynthetic process
• GO:0006065 UDP-glucuronate biosynthetic process
• GO:0009103 lipopolysaccharide biosynthetic process
• GO:0009243 O antigen biosynthetic process
• GO:0051262 protein tetramerization
• GO:0071555 cell wall organization

External links

• PDB: RCSB:3oa2, PDBe:3oa2, PDBj:3oa2
• PDBsum: 3oa2
• PubMed: 20690587
• UniProt: G3XD23|WBPB_PSEAE UDP-N-acetyl-2-amino-2-deoxy-D-glucuronate oxidase (Gene Name=wbpB)