Structure of PDB 3o73 Chain B

Receptor sequence

>3o73B (length=230) Species: 9606 (Homo sapiens) [Search protein sequence]

AGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRA
TDKDITGTLSNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQ
FPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQGKLALLSVTTGG
TAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEER
KGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ

3D structure

PDB

3o73 Mechanism-Based Inhibition of Quinone Reductase 2 (NQO2): Selectivity for NQO2 over NQO1 and Structural Basis for Flavoprotein Inhibition.

Chain

Resolution

2.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G149 Y155 N161
Catalytic site (residue number reindexed from 1)	G149 Y155 N161
Enzyme Commision number	1.10.5.1: ribosyldihydronicotinamide dehydrogenase (quinone).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	O73	B	C121 F126 F178	C121 F126 F178
BS02	O73	B	W105 G149 G150 E193	W105 G149 G150 E193
BS03	ZN	B	H173 H177 C222	H173 H177 C222
BS04	FAD	B	H11 S16 F17 N18 S20 P102 L103 Y104 W105 F106 T147 T148 G149 G150 Y155 E193 E197 R200	H11 S16 F17 N18 S20 P102 L103 Y104 W105 F106 T147 T148 G149 G150 Y155 E193 E197 R200

Gene Ontology

	Molecular Function
GO:0001512	dihydronicotinamide riboside quinone reductase activity
GO:0003955	NAD(P)H dehydrogenase (quinone) activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0016661	oxidoreductase activity, acting on other nitrogenous compounds as donors
GO:0031404	chloride ion binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0071949	FAD binding
GO:1904408	melatonin binding
GO:1905594	resveratrol binding

	Biological Process
GO:1901662	quinone catabolic process

	Cellular Component
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3o73, PDBe:3o73, PDBj:3o73
PDBsum	3o73
PubMed	21506232
UniProt	P16083\|NQO2_HUMAN Ribosyldihydronicotinamide dehydrogenase [quinone] (Gene Name=NQO2)

[Back to BioLiP]