Structure of PDB 3o6r Chain B

Receptor sequence

>3o6rB (length=256) Species: 37919 (Rhodococcus opacus)

ANTRVIELFDEFTDLIRDFIVRHEITTPEYETIMQYMISVGEAGEWPLWL
DAFFETTVDSVSYGKGNWTSSAIQGPFFKEGAPLLTGKPATLPMRADEPG
DRMRFTGSVRDTSGTPITGAVIDVWHSTNDGNYSFFSPALPDQYLLRGRV
VPAEDGSIEFHSIRPVPYEIPKAGPTGQLMNSYLGRHSWRPAHIHIRITA
DGYRPLITQLYFEGDPYLDSDSCSAVKSELVLPVNKIDIDGETWQLVDFN
FILQHN

3D structure

• PDB: 3o6r X-ray structures of 4-chlorocatechol 1,2-dioxygenase adducts with substituted catechols: new perspectives in the molecular basis of intradiol ring cleaving dioxygenases specificity.
• Chain: B
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y134 Y169 R191 H194 H196
• Catalytic site (residue number reindexed from 1): Y133 Y168 R190 H193 H195
• Enzyme Commision number: 1.13.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE	B	Y134 H194 H196	Y133 H193 H195
BS02	PYG	B	P77 Y134 R191 H194 H196	P76 Y133 R190 H193 H195

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005506 iron ion binding
• GO:0008199 ferric iron binding
• GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
• GO:0018576 catechol 1,2-dioxygenase activity
• GO:0046872 metal ion binding
• GO:0051213 dioxygenase activity

Biological Process

• GO:0009056 catabolic process
• GO:0009712 catechol-containing compound metabolic process

External links

• PDB: RCSB:3o6r, PDBe:3o6r, PDBj:3o6r
• PDBsum: 3o6r
• PubMed: 23261399
• UniProt: O67987|CLCA_RHOOP Chlorocatechol 1,2-dioxygenase (Gene Name=clcA)