Structure of PDB 3o47 Chain B

Receptor sequence
>3o47B (length=289) Species: 9606 (Homo sapiens) [Search protein sequence]
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHR
GLGVHLSFVRSVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQ
EKYNSRAAALFRDKVVALAEGREWSLEWTPPKEMRILMVGLDAAGKTTIL
YKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGRPLWRHYFQNTQGLI
FVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEI
TDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLR
3D structure
PDB3o47 Crystal structure of ARFGAP1-ARF1 fusion protein
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C22 C25 C42 C45 C22 C25 C42 C45
BS02 GDP B A157 A158 G159 K160 T161 T162 N256 K257 D259 L260 C289 A290 T291 A143 A144 G145 K146 T147 T148 N237 K238 D240 L241 C270 A271 T272
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003723 RNA binding
GO:0003924 GTPase activity
GO:0005096 GTPase activator activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019904 protein domain specific binding
Biological Process
GO:0002090 regulation of receptor internalization
GO:0006878 intracellular copper ion homeostasis
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
GO:0060292 long-term synaptic depression
GO:0097061 dendritic spine organization
GO:0098586 cellular response to virus
GO:1990386 mitotic cleavage furrow ingression
Cellular Component
GO:0000139 Golgi membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0012505 endomembrane system
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030017 sarcomere
GO:0031252 cell leading edge
GO:0032991 protein-containing complex
GO:0043005 neuron projection
GO:0045202 synapse
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3o47, PDBe:3o47, PDBj:3o47
PDBsum3o47
PubMed
UniProtP84077|ARF1_HUMAN ADP-ribosylation factor 1 (Gene Name=ARF1);
Q8N6T3|ARFG1_HUMAN ADP-ribosylation factor GTPase-activating protein 1 (Gene Name=ARFGAP1)

[Back to BioLiP]