Structure of PDB 3o0m Chain B

Receptor sequence

>3o0mB (length=135) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

SCVFCAIVSGDAPAIRIYEDENFLGILDIRPFTRGHTLVIPKTHTVDLTD
TPPETVAGMAAVGQRIARAARESGLHADGNNIAINDGKAAFQTVFHIHLH
VVPRRNGDKLSFRRDPDREESGRLLRAALAQLDSA

3D structure

• PDB: 3o0m Increasing the structural coverage of tuberculosis drug targets.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N86 H97 H99 H101
• Catalytic site (residue number reindexed from 1): N85 H96 H98 H100

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C3 C6 H45 H97	C2 C5 H44 H96
BS02	AMP	B	F5 D29 I30 L39 F92 Q93 T94 V95 H99 H101	F4 D28 I29 L38 F91 Q92 T93 V94 H98 H100

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003824 catalytic activity
• GO:0046872 metal ion binding
• GO:0047627 adenylylsulfatase activity

Biological Process

• GO:0006790 sulfur compound metabolic process
• GO:0009150 purine ribonucleotide metabolic process

External links

• PDB: RCSB:3o0m, PDBe:3o0m, PDBj:3o0m
• PDBsum: 3o0m
• PubMed: 25613812
• UniProt: A0R291