Structure of PDB 3nub Chain B

Receptor sequence

>3nubB (length=358) Species: 287 (Pseudomonas aeruginosa)

MIEFIDLKNQQARIKDKIDAGIQRVLRHGQYILGPEVTELEDRLADFVGA
KYCISCANGTDALQIVQMALGVGPGDEVITPGFTYVATAETVALLGAKPV
YVDIDPRTYNLDPQLLEAAITPRTKAIIPVSLYGQCADFDAINAIASKYG
IPVIEDAAQSFGASYKGKRSCNLSTVACTSFFPSKPLGCYGDGGAIFTND
DELATAIRQIARHGQDRRYHHIRVGVNSRLDTLQAAILLPKLEIFEEEIA
LRQKVAAEYDLSLKQVGIGTPFIEVNNISVYAQYTVRMDNRESVQASLKA
AGVPTAVHYPIPLNKQPAVADEKAKLPVGDKAATQVMSLPMHPYLDTASI
KIICAALT

3D structure

• PDB: 3nub Structural Analysis of WbpE from Pseudomonas aeruginosa PAO1: A Nucleotide Sugar Aminotransferase Involved in O-Antigen Assembly
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y85 D156 Q159 F182 K185 Y219 R229
• Catalytic site (residue number reindexed from 1): Y85 D156 Q159 F182 K185 Y219 R229
• Enzyme Commision number: 2.6.1.98: UDP-2-acetamido-2-deoxy-ribo-hexuluronate aminotransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UD0	B	G29 Y31 N227 R229	G29 Y31 N227 R229
BS02	UD0	B	F4 N58 G59 T60 Y85 A87 D156 A158 Q159 S180 F182 S184 K185 H308 Y309	F4 N58 G59 T60 Y85 A87 D156 A158 Q159 S180 F182 S184 K185 H308 Y309

Gene Ontology

Molecular Function

• GO:0008483 transaminase activity
• GO:0030170 pyridoxal phosphate binding

Biological Process

• GO:0000271 polysaccharide biosynthetic process
• GO:0006065 UDP-glucuronate biosynthetic process
• GO:0009103 lipopolysaccharide biosynthetic process
• GO:0009243 O antigen biosynthetic process
• GO:0071555 cell wall organization

External links

• PDB: RCSB:3nub, PDBe:3nub, PDBj:3nub
• PDBsum: 3nub
• PubMed: 20604544
• UniProt: Q9HZ76|WBPE_PSEAE UDP-2-acetamido-2-deoxy-3-oxo-D-glucuronate aminotransferase (Gene Name=wbpE)