Structure of PDB 3nin Chain B

Receptor sequence
>3ninB (length=80) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VHKHTGRNCGRKFKIGEPLYRCHECGCDDTCVLCIHCFNPKDHVNHHVCT
DICTEFTSGICDCGDEEAWNSPLHCKAEEQ
3D structure
PDB3nin Structural basis for the recognition of N-end rule substrates by the UBR box of ubiquitin ligases
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B T144 V146 T171 S172 G173 I174 D176 A182 T30 V32 T57 S58 G59 I60 D62 A68
BS02 ZN B C123 C148 C151 C175 C9 C34 C37 C61
BS03 ZN B H118 C151 C177 C189 H4 C37 C63 C75
BS04 ZN B C136 C139 H157 H160 C22 C25 H43 H46
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3nin, PDBe:3nin, PDBj:3nin
PDBsum3nin
PubMed20835240
UniProtP19812|UBR1_YEAST E3 ubiquitin-protein ligase UBR1 (Gene Name=UBR1)

[Back to BioLiP]