Structure of PDB 3nil Chain B

Receptor sequence

>3nilB (length=82) Species: 4932 (Saccharomyces cerevisiae)

GSVHKHTGRNCGRKFKIGEPLYRCHECGCDDTCVLCIHCFNPKDHVNHHV
CTDICTEFTSGICDCGDEEAWNSPLHCKAEEQ

3D structure

• PDB: 3nil Structural basis for the recognition of N-end rule substrates by the UBR box of ubiquitin ligases
• Chain: B
• Resolution: 1.75 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C123 C148 C151 C175	C11 C36 C39 C63
BS02	ZN	B	H118 C151 C177 C189	H6 C39 C65 C77
BS03	ZN	B	C136 C139 H157 H160	C24 C27 H45 H48

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0061630 ubiquitin protein ligase activity

Biological Process

• GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

External links

• PDB: RCSB:3nil, PDBe:3nil, PDBj:3nil
• PDBsum: 3nil
• PubMed: 20835240
• UniProt: P19812|UBR1_YEAST E3 ubiquitin-protein ligase UBR1 (Gene Name=UBR1)