Structure of PDB 3ng8 Chain B |
>3ng8B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] |
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINIAVVGPALTFRIR HNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQ |
|
PDB | 3ng8 Structure of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase IA-2. |
Chain | B |
Resolution | 1.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
E542 Q548 |
E73 Q79 |
|
|
|
|