Structure of PDB 3neo Chain B |
>3neoB (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSRRYTIAALL SPYSYSTTAVVTNP |
|
PDB | 3neo The binding of synthetic triiodo l-thyronine analogs to human transthyretin: molecular basis of cooperative and non-cooperative ligand recognition. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
G24 |
B |
S117 T118 T119 |
S106 T107 T108 |
PDBbind-CN: -logKd/Ki=5.92,Kd=1.2uM |
|
|
|