Structure of PDB 3na0 Chain B

Receptor sequence

>3na0B (length=470) Species: 9606 (Homo sapiens) [Search protein sequence]

PRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLG
NVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKS
AAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNY
SGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTS
VPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSV
HHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMAR
NLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTL
QRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKD
KNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVG
TTFNLILMPEKPISFTFWPF

3D structure

PDB

3na0 Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	T330 F455 C462
Catalytic site (residue number reindexed from 1)	T286 F411 C418
Enzyme Commision number	1.14.15.6: cholesterol monooxygenase (side-chain-cleaving).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	B	K148 N155 M159 A160 Q372 K378 K382 F450 W457 G458 V459 Q461	K104 N111 M115 A116 Q328 K334 K338 F406 W413 G414 V415 Q417
BS02	HEM	B	R120 V139 R151 M323 G326 T330 I390 S391 R396 G454 F455 R460 Q461 C462 G464	R76 V95 R107 M279 G282 T286 I346 S347 R352 G410 F411 R416 Q417 C418 G420
BS03	2DC	B	F121 L140 E322 S391 Q395	F77 L96 E278 S347 Q351

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0005515	protein binding
GO:0008386	cholesterol monooxygenase (side-chain-cleaving) activity
GO:0008395	steroid hydroxylase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006694	steroid biosynthetic process
GO:0006700	C21-steroid hormone biosynthetic process
GO:0006704	glucocorticoid biosynthetic process
GO:0008203	cholesterol metabolic process
GO:0008207	C21-steroid hormone metabolic process
GO:0016125	sterol metabolic process
GO:0034650	cortisol metabolic process
GO:0042359	vitamin D metabolic process
GO:0042446	hormone biosynthetic process
GO:0071375	cellular response to peptide hormone stimulus
GO:1901615	organic hydroxy compound metabolic process

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3na0, PDBe:3na0, PDBj:3na0
PDBsum	3na0
PubMed	21636783
UniProt	P05108\|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial (Gene Name=CYP11A1)

[Back to BioLiP]