Structure of PDB 3n9z Chain B

Receptor sequence

>3n9zB (length=470) Species: 9606 (Homo sapiens) [Search protein sequence]

PRPFNEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLG
NVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKS
AAWKKDRVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNY
SGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTS
VPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSV
HHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMAR
NLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTL
QRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKD
KNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVG
TTFNLILMPEKPISFTFWPF

3D structure

PDB

3n9z Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.

Chain

Resolution

2.17 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	T291 F416 C423
Catalytic site (residue number reindexed from 1)	T286 F411 C418
Enzyme Commision number	1.14.15.6: cholesterol monooxygenase (side-chain-cleaving).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	B	K109 N116 M120 A121 K339 K343 F411 W418 G419 V420 Q422	K104 N111 M115 A116 K334 K338 F406 W413 G414 V415 Q417
BS02	HEM	B	R81 V100 R112 G287 T291 I351 R357 G415 F416 R421 Q422 C423 L424 G425	R76 V95 R107 G282 T286 I346 R352 G410 F411 R416 Q417 C418 L419 G420
BS03	HC9	B	F82 I84 L101 E283 S352 Q356	F77 I79 L96 E278 S347 Q351

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0005515	protein binding
GO:0008386	cholesterol monooxygenase (side-chain-cleaving) activity
GO:0008395	steroid hydroxylase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006694	steroid biosynthetic process
GO:0006700	C21-steroid hormone biosynthetic process
GO:0006704	glucocorticoid biosynthetic process
GO:0008203	cholesterol metabolic process
GO:0008207	C21-steroid hormone metabolic process
GO:0016125	sterol metabolic process
GO:0034650	cortisol metabolic process
GO:0042359	vitamin D metabolic process
GO:0042446	hormone biosynthetic process
GO:0071375	cellular response to peptide hormone stimulus
GO:1901615	organic hydroxy compound metabolic process

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3n9z, PDBe:3n9z, PDBj:3n9z
PDBsum	3n9z
PubMed	21636783
UniProt	P05108\|CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial (Gene Name=CYP11A1)

[Back to BioLiP]