Structure of PDB 3n8n Chain B

Receptor sequence
>3n8nB (length=137) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
LIVNVINGPNLGRLGRREPGTTHDELVALIEREAAELGLKAVVRQSDSEA
QLLDWIHQAADAAEPVILNAGGLTHTSVALRDACAELSAPLIEVHISNVH
AREEFRRHSYLSPIATGVIVGLGIQGYLLALRYLAEH
3D structure
PDB3n8n Structural investigation of inhibitor designs targeting 3-dehydroquinate dehydratase from the shikimate pathway of Mycobacterium tuberculosis.
ChainB
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) P11 N12 N75 G78 E99 H101 R108
Catalytic site (residue number reindexed from 1) P9 N10 N69 G72 E93 H95 R102
Enzyme Commision number 4.2.1.10: 3-dehydroquinate dehydratase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 N88 B N75 H101 I102 S103 R112 N69 H95 I96 S97 R106 MOAD: Ki=27uM
Gene Ontology
Molecular Function
GO:0003855 3-dehydroquinate dehydratase activity
GO:0016829 lyase activity
Biological Process
GO:0008652 amino acid biosynthetic process
GO:0009073 aromatic amino acid family biosynthetic process
GO:0009423 chorismate biosynthetic process
GO:0019631 quinate catabolic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3n8n, PDBe:3n8n, PDBj:3n8n
PDBsum3n8n
PubMed21410435
UniProtP9WPX7|AROQ_MYCTU 3-dehydroquinate dehydratase (Gene Name=aroQ)

[Back to BioLiP]