Structure of PDB 3n8b Chain B |
>3n8bB (length=74) Species: 139 (Borreliella burgdorferi) [Search protein sequence] |
EVYSEKMFTESERTYFMNVKENRKGDYFLNIVESKRSPSGDFERHSIFVY EENMNEFESNLLKAIAVIKQKVST |
|
PDB | 3n8b Of bits and bugs--on the use of bioinformatics and a bacterial crystal structure to solve a eukaryotic repeat-protein structure. |
Chain | B |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
T19 S21 |
T9 S11 |
|
|
|
|