Structure of PDB 3n7s Chain B

Receptor sequence
>3n7sB (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
IQLGVTRNKIMTAQYECYQKIMQDAEGVYCNRTWDGWLCWNDVAAGTESM
QLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVN
3D structure
PDB3n7s Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism.
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 3N7 B A44 E47 C48 K51 C74 W75 N76 S84 Q86 A13 E16 C17 K20 C39 W40 N41 S49 Q51
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004948 calcitonin receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3n7s, PDBe:3n7s, PDBj:3n7s
PDBsum3n7s
PubMed20826335
UniProtQ16602|CALRL_HUMAN Calcitonin gene-related peptide type 1 receptor (Gene Name=CALCRL)

[Back to BioLiP]