Structure of PDB 3n5x Chain B

Receptor sequence

>3n5xB (length=411) Species: 10116 (Rattus norvegicus)

RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPVRTKDQLFPL
AKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKH
AWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRS
AITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQ
QGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDL
GLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNIL
EEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATES
FIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQ
PDPWNTHVWKG

3D structure

• PDB: 3n5x Role of zinc in isoform-selective inhibitor binding to neuronal nitric oxide synthase .
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C415 R418 W587 E592
• Catalytic site (residue number reindexed from 1): C108 R111 W280 E285
• Enzyme Commision number: 1.14.13.39: nitric-oxide synthase (NADPH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	XFK	B	W306 F691 H692	W8 F384 H385	MOAD: Ki=103nM BindingDB: Ki=103nM
BS02	ZN	B	C326 C331	C28 C33
BS03	HEM	B	W409 C415 M570 F584 W587 E592 R596 W678 F704	W102 C108 M263 F277 W280 E285 R289 W371 F397
BS04	XFK	B	M336 V567 F584 W587 E592 R596 W678	M38 V260 F277 W280 E285 R289 W371	MOAD: Ki=103nM BindingDB: Ki=103nM
BS05	XFK	B	R596 D600 V677 W678	R289 D293 V370 W371	MOAD: Ki=103nM BindingDB: Ki=103nM
BS06	CL	B	R596 D600	R289 D293

Gene Ontology

Molecular Function

• GO:0004517 nitric-oxide synthase activity

Biological Process

• GO:0006809 nitric oxide biosynthetic process

External links

• PDB: RCSB:3n5x, PDBe:3n5x, PDBj:3n5x
• PDBsum: 3n5x
• PubMed: 21138269
• UniProt: P29476|NOS1_RAT Nitric oxide synthase 1 (Gene Name=Nos1)