Structure of PDB 3n3b Chain B

Receptor sequence

>3n3bB (length=284) Species: 83333 (Escherichia coli K-12)

RISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQ
LTMRVFTGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARS
YSSIFSTLCQTKDVDAAYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIAS
VFLESFLFYSGFWLPMYFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQ
KNMEKISLGQREELKSFAFDLLLELYDNELQYTDELYAETPWADDVKAFL
CYNANKALMNLGYEPLFPAEMAEVNPAILAALSP

3D structure

• PDB: 3n3b Structural basis for activation of class Ib ribonucleotide reductase.
• Chain: B
• Resolution: 2.36 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P85 D191
• Catalytic site (residue number reindexed from 1): P81 D187
• Enzyme Commision number: 1.17.4.1: ribonucleoside-diphosphate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	B	D67 E98 H101 E158 E192	D63 E94 H97 E154 E188
BS02	MN	B	E98 E158 E192 H195	E94 E154 E188 H191
BS03	FMN	B	R25 Y197	R21 Y193

Gene Ontology

Molecular Function

• GO:0004748 ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0030145 manganese ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009185 ribonucleoside diphosphate metabolic process
• GO:0009263 deoxyribonucleotide biosynthetic process
• GO:0009265 2'-deoxyribonucleotide biosynthetic process

Cellular Component

• GO:0005971 ribonucleoside-diphosphate reductase complex

External links

• PDB: RCSB:3n3b, PDBe:3n3b, PDBj:3n3b
• PDBsum: 3n3b
• PubMed: 20688982
• UniProt: P37146|RIR4_ECOLI Ribonucleoside-diphosphate reductase 2 subunit beta (Gene Name=nrdF)