Structure of PDB 3n1e Chain B |
>3n1eB (length=141) Species: 10090 (Mus musculus) [Search protein sequence] |
MDQWSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVP SPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLN VINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWE |
|
PDB | 3n1e Structural basis for the wobbler mouse neurodegenerative disorder caused by mutation in the Vps54 subunit of the GARP complex. |
Chain | B |
Resolution | 1.702 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
P940 Q941 |
P107 Q108 |
|
|
|
|