Structure of PDB 3n01 Chain B |
>3n01B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] |
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIR HNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQ |
|
PDB | 3n01 Structure of the mature Ectodomain of the Human receptor-type Protein-Tyrosine Phosphatase IA-2 |
Chain | B |
Resolution | 1.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
E542 Q548 |
E70 Q76 |
|
|
|
|