Structure of PDB 3mxb Chain B

Receptor sequence

>3mxbB (length=153) Species: 3055 (Chlamydomonas reinhardtii)

NTKYNEEFLLYLAGFVDSDGSIIAQIKPRQSNKFKHQLSLTFAVTQKTQR
RWFLDKLVDEIGVGYVYDSGSVSDYRLSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LDS

3D structure

• PDB: 3mxb Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.
• Chain: B
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	R30 S32 N33 K34 Q38 Y66 Y68 E80 I81 K116 K139	R29 S31 N32 K33 Q37 Y65 Y67 E79 I80 K115 K138	PDBbind-CN: Kd=28nM
BS02	dna	B	S19 D20 G21 S22 I24 Q26 K28 T46 Q47 K48 R51 R77 N136 D137 S138 T140 R141 K142	S18 D19 G20 S21 I23 Q25 K27 T45 Q46 K47 R50 R76 N135 D136 S137 T139 R140 K141	PDBbind-CN: Kd=28nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 24 11:58:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3mxb', asym_id = 'B', title = 'Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3mxb', asym_id='B', title='Molecular basis of engineered meganuclease targeting of the endogenous human RAG1 locus.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '3mxb', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='3mxb', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>