Structure of PDB 3mu6 Chain B

Receptor sequence
>3mu6B (length=71) Species: 9606 (Homo sapiens) [Search protein sequence]
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSS
NKLFQYASTDMDKVLLKYTAY
3D structure
PDB3mu6 Inhibition of the function of class IIa HDACs by blocking their interaction with MEF2.
ChainB
Resolution2.434 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G2 R3 K31 G1 R2 K30
BS02 dna B G2 R3 I6 K23 R24 K30 G1 R2 I5 K22 R23 K29
BS03 dna B F26 K30 Y33 Y57 F25 K29 Y32 Y56
BS04 BXL B L66 L67 Y69 T70 L65 L66 Y68 T69
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3mu6, PDBe:3mu6, PDBj:3mu6
PDBsum3mu6
PubMed22396528
UniProtQ02078|MEF2A_HUMAN Myocyte-specific enhancer factor 2A (Gene Name=MEF2A)

[Back to BioLiP]