Structure of PDB 3msz Chain B |
>3mszB (length=87) Species: 177416 (Francisella tularensis subsp. tularensis SCHU S4) [Search protein sequence] |
AMKVKIYTRNGCPYCVWAKQWFEENNIAFDETIIDDYAQRSKFYDEMNQS GKVIFPISTVPQIFIDDEHIGGFTELKANADKILNKK |
|
PDB | 3msz Crystal Structure of Glutaredoxin 1 from Francisella tularensis Complexed with Cacodylate |
Chain | B |
Resolution | 2.053 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GSH |
B |
K2 K4 F63 D66 |
K3 K5 F64 D67 |
|
|
|
|