Structure of PDB 3mm7 Chain B

Receptor sequence

>3mm7B (length=363) Species: 2234 (Archaeoglobus fulgidus)

EGVKTDFGPPYFRDLLHPVIAKNYGKWKYHEVVKPGVIKRVAESGDVIYV
VRFGTPRLLSIYTVRELCDIADKYSDGYLRWTSRNNVEFFVTDESKIDDL
INEVQERVGFPCGGTWDAVKGEYGLSNIVHTQGWIHCHTPAIDASGIVKA
VMDELYEYFTDHKLPAMCRISLACCANMCGAVHASDIAIVGIHRTPPIPN
DEAIRKTCEIPSTVAACPTGALKPDMKNKTIKVDVEKCMYCGNCYTMCPG
MPLFDPENDGAAIMVGGKLSEARRMPELSKVVVPWVPNEPPRWPTLVKYV
KQILEAWAANANKHERLIEWVDRIGWERFFELTGLEFTQHLIDDYRITPY
FYSEFRASTQFKW

3D structure

• PDB: 3mm7 Reaction cycle of the dissimilatory sulfite reductase from Archaeoglobus fulgidus.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 1.8.1.22: dissimilatory sulfite reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SRM	B	R60 T134 H139 H141 N180 C182 G183	R57 T131 H136 H138 N177 C179 G180
BS02	SF4	B	T134 C140 T142 P143 C177 C178 N180 C182	T131 C137 T139 P140 C174 C175 N177 C179
BS03	SF4	B	P200 C220 L225 C241 M242 Y243 C244 G245 C247	P197 C217 L222 C238 M239 Y240 C241 G242 C244
BS04	SRM	B	H33 I41 R43 R55 R83 T85 S86 R87 T118 W119 A121 S129 M170 R172 L272 S273 R276 R319	H30 I38 R40 R52 R80 T82 S83 R84 T115 W116 A118 S126 M167 R169 L269 S270 R273 R316

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016002 sulfite reductase activity
• GO:0016491 oxidoreductase activity
• GO:0018551 dissimilatory sulfite reductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0050311 sulfite reductase (ferredoxin) activity
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0000103 sulfate assimilation
• GO:0006790 sulfur compound metabolic process

Cellular Component

• GO:0009337 sulfite reductase complex (NADPH)
• GO:0016020 membrane

External links

• PDB: RCSB:3mm7, PDBe:3mm7, PDBj:3mm7
• PDBsum: 3mm7
• PubMed: 20822098
• UniProt: Q59110|DSRB_ARCFU Sulfite reductase, dissimilatory-type subunit beta (Gene Name=dsrB)