Structure of PDB 3mju Chain B

Receptor sequence

>3mjuB (length=146) Species: 8932 (Columba livia)

VHWSAEEKQLITSIWGKVNVADCGAEALARLLIVYPWTQRFFSSFGNLSS
ATAISGNPNVKAHGKKVLTSFGDAVKNLDNIKGTFAQLSELHCDKLHVDP
ENFRLLGDILVIILAAHFGKDFTPECQAAWQKLVRVVAHALARKYH

3D structure

• PDB: 3mju Crystal structure determination of pigeon (columba livia) haemoglobin at 3.5 angstrom resolution
• Chain: B
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	F42 H63 S70 F71 L88 H92 V98 N102 F103 L106 L141	F42 H63 S70 F71 L88 H92 V98 N102 F103 L106 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3mju, PDBe:3mju, PDBj:3mju
• PDBsum: 3mju
• UniProt: P11342|HBB_COLLI Hemoglobin subunit beta (Gene Name=HBB)