Structure of PDB 3mhx Chain B |
>3mhxB (length=81) Species: 522373 (Stenotrophomonas maltophilia K279a) [Search protein sequence] |
AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGEP LLVQVGFTRFALRISEAKRVVVDAASQERRA |
|
PDB | 3mhx Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport activating factor |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CL |
B |
R66 S68 |
R63 S65 |
|
|
|
|