Structure of PDB 3mf1 Chain B

Receptor sequence

>3mf1B (length=275) Species: 224911 (Bradyrhizobium diazoefficiens USDA 110)

DPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRF
PPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWTT
SLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLD
RLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYALKFE
LLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHTGCVAFGMDRL
AVAMFHTHGTDLSAWPAKVRDILGL

3D structure

• PDB: 3mf1 Homologs of aminoacyl-tRNA synthetases acylate carrier proteins and provide a link between ribosomal and nonribosomal peptide synthesis
• Chain: B
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C131 R159 E161 R168 E176 K235 A250 S253 C279 R286
• Catalytic site (residue number reindexed from 1): C114 R142 E144 R151 E159 K198 A213 S216 C242 R249
• Enzyme Commision number: 6.2.1.n2: amino acid--[acyl-carrier-protein] ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C131 E176 C279	C114 E159 C242
BS02	G5A	B	R159 E161 L169 F172 M174 E176 K235 A250 C251 S253 C279 A281 G283 R286	R142 E144 L152 F155 M157 E159 K198 A213 C214 S216 C242 A244 G246 R249

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006418 tRNA aminoacylation for protein translation

External links

• PDB: RCSB:3mf1, PDBe:3mf1, PDBj:3mf1
• PDBsum: 3mf1
• PubMed: 20663952
• UniProt: Q89VT8|AACL1_BRADU Amino acid--[acyl-carrier-protein] ligase 1 (Gene Name=bll0957)