Structure of PDB 3mde Chain B

Receptor sequence

>3mdeB (length=385) Species: 9823 (Sus scrofa) [Search protein sequence]

GFSFELTEQQKEFQATARKFAREEIIPVAAEYDRTGEYPVPLLKRAWELG
LMNTHIPESFGGLGLGIIDSCLITEELAYGCTGVQTAIEANTLGQVPLII
GGNYQQQKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYII
NGQKMWITNGGKANWYFLLARSDPDPKAPASKAFTGFIVEADTPGVQIGR
KEINMGQRCSDTRGIVFEDVRVPKENVLTGEGAGFKIAMGTFDKTRPPVA
AGAVGLAQRALDEATKYALERKTFGKLLAEHQGISFLLADMAMKVELARL
SYQRAAWEIDSGRRNTYYASIAKAYAADIANQLATDAVQVFGGNGFNTEY
PVEKLMRDAKIYQIYEGTAQIQRIIIAREHIGRYK

3D structure

PDB

3mde Crystal structures of medium-chain acyl-CoA dehydrogenase from pig liver mitochondria with and without substrate.

Chain

Resolution

2.4 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	V135 T136 T255 E376 R388
Catalytic site (residue number reindexed from 1)	V125 T126 T245 E366 R378
Enzyme Commision number	1.3.8.7: medium-chain acyl-CoA dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FAD	B	R281 T283 F284 L288 H291 I294 Q349 V350 G353	R271 T273 F274 L278 H281 I284 Q339 V340 G343
BS02	CO8	B	T96 E99 L103 G141 S142 V144 S191 F245 M249 F252 Y375 E376 G377	T86 E89 L93 G131 S132 V134 S181 F235 M239 F242 Y365 E366 G367
BS03	FAD	B	Y133 V135 T136 G141 S142 W166 T168 I371 Y375 T378 Q380	Y123 V125 T126 G131 S132 W156 T158 I361 Y365 T368 Q370

Gene Ontology

	Molecular Function
GO:0003995	acyl-CoA dehydrogenase activity
GO:0016491	oxidoreductase activity
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors
GO:0042802	identical protein binding
GO:0050660	flavin adenine dinucleotide binding
GO:0070991	medium-chain fatty acyl-CoA dehydrogenase activity

	Biological Process
GO:0001889	liver development
GO:0005978	glycogen biosynthetic process
GO:0006082	organic acid metabolic process
GO:0006111	regulation of gluconeogenesis
GO:0006631	fatty acid metabolic process
GO:0006635	fatty acid beta-oxidation
GO:0007507	heart development
GO:0009409	response to cold
GO:0009437	carnitine metabolic process
GO:0009791	post-embryonic development
GO:0019254	carnitine metabolic process, CoA-linked
GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase
GO:0042594	response to starvation
GO:0045329	carnitine biosynthetic process
GO:0051791	medium-chain fatty acid metabolic process
GO:0051793	medium-chain fatty acid catabolic process
GO:0055007	cardiac muscle cell differentiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0030424	axon
GO:0031966	mitochondrial membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3mde, PDBe:3mde, PDBj:3mde
PDBsum	3mde
PubMed	8356049
UniProt	P41367\|ACADM_PIG Medium-chain specific acyl-CoA dehydrogenase, mitochondrial (Gene Name=ACADM)

[Back to BioLiP]