Structure of PDB 3mco Chain B

Receptor sequence
>3mcoB (length=386) Species: 376619 (Francisella tularensis subsp. holarctica LVS) [Search protein sequence]
HMVQYIIGIGTNSGFTIENIHLAITALESQQNIRIIRKASLYSSKAVIRF
LNTAVKISSSLKPDELLVLLKDIELKIRVIDLDILAAEDLILETDKLTIP
HKELINRSFALAPLLELSKGWHHPKYVEWDLNIRLKELGEIVKLKQTLAN
TIRMGIVNLSNQSFSDGNFDDNQRKLNLDELIQSGAEIIDIGAESTKPDA
KPISIEEEFNKLNEFLEYFKSQLANLIYKPLVSIDTRKLEVMQKILAKHH
DIIWMINDVECNNIEQKAQLIAKYNKKYVIIHNNAIDNVCDYIEQKKQIL
LKHGIAQQNIYFDIGFGFGKKSDTARYLLENIIEIKRRLELKALVGHSRK
PSVLGLTKLATLDRATRELSRKLEKLDIDIIRVHKI
3D structure
PDB3mco Crystal structure of the 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase.dihydropteroate synthase bifunctional enzyme from Francisella tularensis.
ChainB
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PH2 B S43 V46 F59 N61 R98 F129 S44 V47 F50 N52 R78 F109
BS02 PH2 B N277 I301 D346 F351 K383 R418 N257 I281 D313 F318 K350 R382
BS03 APC B L76 K80 D101 D103 I104 K116 L117 T118 H121 R127 L67 K71 D81 D83 I84 K96 L97 T98 H101 R107
BS04 MG B D101 D103 D81 D83
BS05 MG B D101 D103 D81 D83
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 10:42:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3mco', asym_id = 'B', title = 'Crystal structure of the 6-hydroxymethyl-7,8-dih...bifunctional enzyme from Francisella tularensis. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3mco', asym_id='B', title='Crystal structure of the 6-hydroxymethyl-7,8-dih...bifunctional enzyme from Francisella tularensis. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003848,0004156,0009396,0042558,0044237', uniprot = '', pdbid = '3mco', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003848,0004156,0009396,0042558,0044237', uniprot='', pdbid='3mco', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>