Structure of PDB 3m9f Chain B

Receptor sequence

>3m9fB (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGI
GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

3D structure

• PDB: 3m9f Epsilon substituted lysinol derivatives as HIV-1 protease inhibitors.
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	595	B	D25 G27 A28 G48 G49 I50 P81 I84	D25 G27 A28 G48 G49 I50 P81 I84	MOAD: ic50=0.007nM PDBbind-CN: -logKd/Ki=11.15,IC50=0.007nM
BS02	595	B	D25 G27 A28 D29 G48 G49 I50 P81 V82 I84	D25 G27 A28 D29 G48 G49 I50 P81 V82 I84	MOAD: ic50=0.007nM PDBbind-CN: -logKd/Ki=11.15,IC50=0.007nM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:3m9f, PDBe:3m9f, PDBj:3m9f
• PDBsum: 3m9f
• PubMed: 20547452
• UniProt: Q9WFL7